PDB entry 2euf

View 2euf on RCSB PDB site
Description: X-ray structure of human CDK6-Vcyclin in complex with the inhibitor PD0332991
Class: cell cycle/transferase
Keywords: inhibitor complex of human cyclin-dependent kinase 6, CELL CYCLE-TRANSFERASE COMPLEX
Deposited on 2005-10-28, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.233
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral Cyclin
    Species: Herpesvirus saimiri (strain 11) [TaxId:10383]
    Gene: 72, ECLF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2eufa1, d2eufa2
  • Chain 'B':
    Compound: cell division protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2eufb_
  • Heterogens: CA, ACT, LQQ, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eufA (A:)
    madspnrlnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmh
    llcesfeldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvsklt
    ylscdcftnlelinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaastt
    ickaliqpniallspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkd
    qvseafslydleil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eufA (A:)
    lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
    ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
    elinqekdilealkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpni
    allspglicaggllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd
    leil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eufB (B:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlercke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eufB (B:)
    dqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhle
    tfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfql
    lrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrape
    vllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpaqpie
    kfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler