PDB entry 2eu7

View 2eu7 on RCSB PDB site
Description: Crystal structure of D1A mutant of nitrophorin 2 complexed with ammonia
Class: transport protein
Keywords: beta barrel, lipocalin, ferric heme, mutant, TRANSPORT PROTEIN
Deposited on 2005-10-28, released 2006-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.179
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Nitrophorin 2
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26241 (0-178)
      • engineered (0)
    Domains in SCOPe 2.08: d2eu7x_
  • Heterogens: HEM, NH3, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eu7X (X:)
    acstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyna
    nkktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhi
    clregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl