PDB entry 2eu0

View 2eu0 on RCSB PDB site
Description: The NMR ensemble structure of the Itk SH2 domain bound to a phosphopeptide
Class: transferase
Keywords: cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, phosphotyrosine binding, TRANSFERASE
Deposited on 2005-10-27, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Mus musculus [TaxId:10090]
    Gene: Itk, Emt, Tlk, Tsk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03526 (0-106)
      • cloning artifact (107)
    Domains in SCOPe 2.07: d2eu0a1, d2eu0a2
  • Chain 'B':
    Compound: Lymphocyte cytosolic protein 2 phosphopeptide fragment
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60787 (0-5)
      • modified residue (2)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eu0A (A:)
    nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
    yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg
    

  • Chain 'B':
    No sequence available.