PDB entry 2etz

View 2etz on RCSB PDB site
Description: The NMR minimized average structure of the Itk SH2 domain bound to a phosphopeptide
Class: transferase
Keywords: cis/trans isomerization, interleukin-2 tyrosine kinase, Itk, t-cell specific kinase, tsk, src homology 2, SH2, proline, phosphotyrosine binding, TRANSFERASE
Deposited on 2005-10-27, released 2006-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase ITK/TSK
  Species: Mus musculus [TaxId:10090]
  Gene: Itk, Emt, Tlk, Tsk
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03526 (0-106)
    • cloning artifact (107)
  Domains in SCOPe 2.07: d2etza1, d2etza2
• Chain 'B':
  Compound: Lymphocyte cytosolic protein 2 phosphopeptide fragment
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60787 (0-5)
    • modified residue (2)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2etzA (A:)
  nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
  yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvcg
  

  
  
• Chain 'B':
  No sequence available.