PDB entry 2ets

View 2ets on RCSB PDB site
Description: crystal structure of a bacterial domain of unknown function from duf1798 family (mw1337) from staphylococcus aureus subsp. aureus at 2.25 a resolution
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on 2005-10-27, released 2005-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.175
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
    Gene: np_646154.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NWP7 (12-End)
      • leader sequence (7-11)
      • modified residue (12)
      • modified residue (26)
      • see remark 999 (56)
      • modified residue (73)
    Domains in SCOPe 2.06: d2etsa1, d2etsa2
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2etsA (A:)
mgsdkihhhhhhmndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilne
iklhrefiievpymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildg
vtkegtdg

    Sequence, based on observed residues (ATOM records): (download) 
    >2etsA (A:)
hhhhhmndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilneiklhref
iievpymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildgvt