PDB entry 2ets
View 2ets on RCSB PDB site
Description: crystal structure of a bacterial domain of unknown function from duf1798 family (mw1337) from staphylococcus aureus subsp. aureus at 2.25 a resolution
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, unknown function
Deposited on
2005-10-27, released
2005-11-08
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.175
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hypothetical protein
Species: Staphylococcus aureus subsp. aureus [TaxId:196620]
Gene: np_646154.1
Database cross-references and differences (RAF-indexed):
- Uniprot Q8NWP7 (12-End)
- leader sequence (7-11)
- modified residue (12)
- modified residue (26)
- see remark 999 (56)
- modified residue (73)
Domains in SCOPe 2.04: d2etsa1 - Heterogens: PO4, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2etsA (A:)
mgsdkihhhhhhmndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilne
iklhrefiievpymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildg
vtkegtdg
Sequence, based on observed residues (ATOM records): (download)
>2etsA (A:)
hhhhhmndlvesliyevnnmqqnfenvksqqqdhdfyqtvkpytehidsilneiklhref
iievpymnsrkfellianieqlsvechfkrtsrklfieklksvqydlqnildgvt