PDB entry 2etn

View 2etn on RCSB PDB site
Description: Crystal structure of Thermus aquaticus Gfh1
Class: transcription
Keywords: anti Gre-factor, RNA polymerase, transcript cleavage, TRANSCRIPTION
Deposited on 2005-10-27, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.257
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus aquaticus [TaxId:271]
    Gene: gfh1
    Database cross-references and differences (RAF-indexed):
    • GB AAL57610
    Domains in SCOPe 2.07: d2etna1, d2etna2
  • Chain 'B':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus aquaticus [TaxId:271]
    Gene: gfh1
    Database cross-references and differences (RAF-indexed):
    • GB AAL57610
    Domains in SCOPe 2.07: d2etnb1, d2etnb2
  • Chain 'C':
    Compound: anti-cleavage anti-GreA transcription factor Gfh1
    Species: Thermus aquaticus [TaxId:271]
    Gene: gfh1
    Database cross-references and differences (RAF-indexed):
    • GB AAL57610
    Domains in SCOPe 2.07: d2etnc1, d2etnc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2etnA (A:)
    marevkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekariea
    ridsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkis
    daspmgkallghrvgdvlsldtpkgkkefrvvaihgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etnA (A:)
    revkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekarieari
    dsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisda
    spmgkallghrvgdvlsldtpkgkkefrvvaihg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2etnB (B:)
    marevkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekariea
    ridsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkis
    daspmgkallghrvgdvlsldtpkgkkefrvvaihgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etnB (B:)
    arevkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekariear
    idsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisd
    aspmgkallghrvgdvlsldtpkgkkefrvvaihg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2etnC (C:)
    marevkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekariea
    ridsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkis
    daspmgkallghrvgdvlsldtpkgkkefrvvaihgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etnC (C:)
    arevkltkagyerlmkqleqererlqeatkilqelmessddyddsgleaakqekariear
    idsledvlsravileegtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisd
    aspmgkallghrvgdvlsldtpkgkkefrvvaihg