PDB entry 2etj

View 2etj on RCSB PDB site
Description: Crystal structure of Ribonuclease HII (EC 3.1.26.4) (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution
Class: hydrolase
Keywords: tm0915, Ribonuclease HII (EC 3.1.26.4) (RNase HII), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, HYDROLASE
Deposited on 2005-10-27, released 2005-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.179
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease hii
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rnhB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X017 (12-End)
      • modified residue (12)
      • modified residue (73)
      • modified residue (101)
      • modified residue (156)
      • modified residue (162)
    Domains in SCOPe 2.06: d2etja1
  • Heterogens: MG, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2etjA (A:)
    mgsdkihhhhhhmgidelykkefgivagvdeagrgclagpvvaaavvlekeiegindskq
    lspakrerlldeimekaavgigiaspeeidlynifnatklamnralenlsvkpsfvlvdg
    kgielsvpgtclvkgdqkskligaasivakvfrdrlmsefhrmypqfsfhkhkgyatkeh
    lneirkngvlpihrlsfepvlelltddllreffekglisenrferilnllgarksvvfrk
    ertnhnlplf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etjA (A:)
    mgidelykkefgivagvdeagrgclagpvvaaavvlekeieakrerlldeimekaavgig
    iaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtclvkgdqkskli
    gaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpihrlsfepvle
    lltddllreffekglisenrferilnllgar