PDB entry 2ete

View 2ete on RCSB PDB site
Description: Recombinant oxalate oxidase in complex with glycolate
Class: oxidoreductase
Keywords: Double stranded beta-helix, cupin, OXIDOREDUCTASE
Deposited on 2005-10-27, released 2005-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxalate oxidase 1
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2etea1
  • Chain 'B':
    Compound: Oxalate oxidase 1
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2eteb_
  • Heterogens: NAG, MN, GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eteA (A:)
    sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
    vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
    rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
    kalrveagvvellkskfaggs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eteB (B:)
    sdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
    vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
    rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
    kalrveagvvellkskfaggs