PDB entry 2etd

View 2etd on RCSB PDB site
Description: Crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 A resolution
Class: membrane protein
Keywords: Bromodomain-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, membrane protein
Deposited on 2005-10-27, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lemA protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm0961
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X056 (12-End)
      • leader sequence (10-11)
      • modified residue (22)
      • modified residue (45)
      • modified residue (52)
      • modified residue (64)
      • modified residue (69)
      • modified residue (99)
      • modified residue (108)
      • modified residue (130-131)
      • modified residue (137-138)
      • modified residue (153)
      • modified residue (159)
    Domains in SCOPe 2.08: d2etda1, d2etda2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2etdA (A:)
    mgsdkihhhhhhlvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeia
    narakligaktpqesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenria
    varrdyneavkkyntaikkfpgvifakmfgfeekqyfeakpgaeevpevkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2etdA (A:)
    hhlvsleqevqekysqiqnqlqrradlipnlvetvkgyaahekeileeianarakligak
    tpqesaqadaelssalsrllaiaenypnlkadanfrqlmdelagtenriavarrdyneav
    kkyntaikkgfeekqyfeakp