PDB entry 2et1

View 2et1 on RCSB PDB site
Description: Oxalate oxidase in complex with substrate analogue glycolate
Class: oxidoreductase
Keywords: Double stranded beta helix, Cupin, OXIDOREDUCTASE
Deposited on 2005-10-27, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxalate oxidase 1
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45850 (0-200)
      • see remark 999 (0)
    Domains in SCOPe 2.08: d2et1a_
  • Heterogens: MN, GLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2et1A (A:)
    tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
    vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
    rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
    kalrveagvvellkskfaggs