PDB entry 2est

View 2est on RCSB PDB site
Description: Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, serine proteinase
Deposited on 1986-03-24, released 1986-05-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: elastase
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict (65)
  Domains in SCOPe 2.07: d2este_
• Heterogens: 2Z5, SO4, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2estE (E:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn