PDB entry 2ess

View 2ess on RCSB PDB site
Description: Crystal structure of an acyl-ACP thioesterase (NP_810988.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.90 A resolution
Class: hydrolase
Keywords: NP_810988.1, Acyl-ACP thioesterase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, HYDROLASE
Deposited on 2005-10-26, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-ACP thioesterase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Gene: bt2075
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A611 (1-247)
      • modified residue (1)
      • modified residue (27)
      • modified residue (71)
      • modified residue (115)
      • modified residue (203)
    Domains in SCOPe 2.07: d2essa1, d2essa2
  • Heterogens: CA, CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2essA (A:)
    gmseenkigtyqfvaepfhvdfngrltmgvlgnhllncagfhasdrgfgiatlnednytw
    vlsrlaieldempyqyekfsvqtwvenvyrlftdrnfavidkdgkkigyarsvwaminln
    trkpadllalhggsivdyicdepcpiekpsrikvtsnqpvatltakysdidinghvnsir
    yiehildlfpielyqtkrirrfemayvaesyfgdelsffcdevsenefhvevkkngsevv
    crskvife
    

    Sequence, based on observed residues (ATOM records): (download)
    >2essA (A:)
    mseenkigtyqfvaepfhvdfngrltmgvlgnhllncagfhasdrgfgiatlnednytwv
    lsrlaieldempyqyekfsvqtwvenvyrlftdrnfavidkdgkkigyarsvwaminlnt
    rkpalhggsivdyicdepcpiekpsrikvtsnqpvatltakysdidinghvnsiryiehi
    ldlfpielyqtkrirrfemayvaesyfgdelsffcdevsenefhvevkkngsevvcrskv
    ife