PDB entry 2esp

View 2esp on RCSB PDB site
Description: Human ubiquitin-conjugating enzyme (E2) UbcH5b mutant Ile88Ala
Class: ligase
Keywords: ligase
Deposited on 2005-10-26, released 2005-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-conjugating enzyme e2 d2
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2D2, UBC4, UBCH5B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62837 (2-148)
    • cloning artifact (0-1)
    • engineered (89)
  Domains in SCOPe 2.08: d2espa1, d2espa2
• Heterogens: CL, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2espA (A:)
  gamalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfpt
  dypfkppkvafttriyhpninsngsicldalrsqwspaltiskvllsicsllcdpnpddp
  lvpeiariyktdrekynriarewtqkyam