PDB entry 2eso

View 2eso on RCSB PDB site
Description: Human Ubiquitin-Conjugating Enzyme (E2) UbcH5b mutant Ile37Ala
Class: ligase
Keywords: ligase
Deposited on 2005-10-26, released 2005-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, UBC4, UBCH5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (2-148)
      • cloning artifact (0-1)
      • engineered (38)
    Domains in SCOPe 2.08: d2esoa1, d2esoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2esoA (A:)
    gamalkrihkelndlardppaqcsagpvgddmfhwqatamgpndspyqggvffltihfpt
    dypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddp
    lvpeiariyktdrekynriarewtqkyam