PDB entry 2esl

View 2esl on RCSB PDB site
Description: Human Cyclophilin C in Complex with Cyclosporin A
Class: isomerase/immunosuppressant
Keywords: ISOMERASE-IMMUNOSUPPRESSANT COMPLEX, CYCLOPHILIN-CYCLOSPORIN COMPLEX, CYCLOSPORIN A, IMMUNOSUPRESSANT, CYCLOPHILIN, SGC, Structural Genomics, Structural Genomics Consortium
Deposited on 2005-10-26, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2esla1
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eslb_
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eslc_
  • Chain 'D':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2esld_
  • Chain 'E':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2esle_
  • Chain 'F':
    Compound: peptidyl-prolyl cis-trans isomerase c
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIC, CYPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2eslf_
  • Chain 'I':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'J':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'K':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'L':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'M':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'N':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: CA, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eslA (A:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslA (A:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eslB (B:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslB (B:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2eslC (C:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslC (C:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2eslD (D:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslD (D:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2eslE (E:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslE (E:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2eslF (F:)
    gsgaegfrkrgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygy
    kgskfhrvikdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtn
    gsqffitltkptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvk
    tpfvveiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eslF (F:)
    rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
    kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
    kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
    w
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.