PDB entry 2esh

View 2esh on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function TM0937- a Potential Transcriptional Factor
Class: structural genomics, unknown function
Keywords: TM0937, APC5794, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-10-26, released 2005-12-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein TM0937
  Species: THERMOTOGA MARITIMA [TaxId:243274]
  Database cross-references and differences (RAF-indexed):
  • GB AAD36018
  Domains in SCOPe 2.05: d2esha1
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2eshA (A:)
  mrhrggrgfrgwwlastilllvaekpshgyelaerlaefgieipgighmgniyrvladle
  esgflstewdttvspprkiyritpqgklylreilrsledmkrrietleerikrvlqee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2eshA (A:)
  rggrgfrgwwlastilllvaekpshgyelaerlaefgieipgighmgniyrvladleesg
  flstewdttvspprkiyritpqgklylreilrsledmkrrietleerikrvlqe