PDB entry 2es7

View 2es7 on RCSB PDB site
Description: Crystal structure of Q8ZP25 from Salmonella typhimurium LT2. NESG TARGET STR70
Class: isomerase
Keywords: structural genomics, psi, protein structure initiative, northeast structural genomics consortium, nesg, isomerase
Deposited on 2005-10-25, released 2005-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.285
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative thiol-disulfide isomerase and thioredoxin
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM1790
    Database cross-references and differences (RAF-indexed):
    • GB AAL20705
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.06: d2es7a1
  • Chain 'B':
    Compound: putative thiol-disulfide isomerase and thioredoxin
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM1790
    Database cross-references and differences (RAF-indexed):
    • GB AAL20705
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.06: d2es7b_
  • Chain 'C':
    Compound: putative thiol-disulfide isomerase and thioredoxin
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM1790
    Database cross-references and differences (RAF-indexed):
    • GB AAL20705
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.06: d2es7c_
  • Chain 'D':
    Compound: putative thiol-disulfide isomerase and thioredoxin
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: STM1790
    Database cross-references and differences (RAF-indexed):
    • GB AAL20705
      • modified residue (56)
      • modified residue (119)
    Domains in SCOPe 2.06: d2es7d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2es7A (A:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2es7A (A:)
    fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
    qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2es7B (B:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2es7B (B:)
    fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
    qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2es7C (C:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2es7C (C:)
    fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
    qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2es7D (D:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2es7D (D:)
    fsalwqrlltrgwqpveasvgdgvillssdprrsdnpvmiaellrefpqfdwqvavadle
    qseaigdrfnvrrfpatlvftdgalsgihpwaelltlmrsivd