PDB entry 2es2

View 2es2 on RCSB PDB site
Description: Crystal Structure Analysis of the Bacillus Subtilis Cold Shock Protein Bs-CspB in Complex with Hexathymidine
Class: gene regulation
Keywords: beta barrel, protein-DNA complex, single-stranded DNA,
Deposited on 2005-10-25, released 2006-09-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.19
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cold shock protein cspB
    Species: Bacillus subtilis
    Gene: cspB, cspA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2es2a1
  • Chain 'B':
    Compound: 5'-d(*tp*tp*tp*tp*tp*t)-3'
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2es2A (A:)
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

  • Chain 'B':
    No sequence available.