PDB entry 2erx

View 2erx on RCSB PDB site
Description: Crystal Structure of DiRas2 in Complex With GDP and Inorganic Phosphate
Class: transport protein
Keywords: DIRAS2, GTP hydrolysis, TRANSPORT PROTEIN
Deposited on 2005-10-25, released 2005-11-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.163
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Di-Ras2
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2erxa1
  • Chain 'B':
    Compound: GTP-binding protein Di-Ras2
    Species: Homo sapiens [TaxId:9606]
    Gene: DIRAS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2erxb_
  • Heterogens: PO4, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2erxA (A:)
    sndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttg
    shqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgdvesipimlvgnkcd
    espsrevqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erxA (A:)
    ndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttgs
    hqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgsipimlvgnkcdesps
    revqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2erxB (B:)
    sndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscdksictlqitdttg
    shqfpamqrlsiskghafilvysitsrqsleelkpiyeqiceikgdvesipimlvgnkcd
    espsrevqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erxB (B:)
    sndyrvavfgaggvgksslvlrfvkgtfresyiptvedtyrqviscsictlqitdttgsh
    qfpamqrlsiskghafilvysitsrqsleelkpiyeqiceiksipimlvgnkcdespsre
    vqsseaealartwkcafmetsaklnhnvkelfqellnlekrrtvsl