PDB entry 2erw

View 2erw on RCSB PDB site
Description: Crystal Structure of Infestin 4, a factor XIIa inhibitor
Class: blood clotting, hydrolase inhibitor
Keywords: Kazal type domain
Deposited on 2005-10-25, released 2006-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.181
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease inhibitor infestin
    Species: Triatoma infestans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2erwa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2erwA (A:)
    evrnpcacfrnyvpvcgsdgktygnpcmlncaaqtkvpglklvhegrcqrsnveqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erwA (A:)
    npcacfrnyvpvcgsdgktygnpcmlncaaqtkvpglklvhegrcqrsnveqf