PDB entry 2ers

View 2ers on RCSB PDB site
Description: Solution structure of the Interleukin-15 receptor sushi domain
Class: signaling protein
Keywords: sushi domain, SIGNALING PROTEIN
Deposited on 2005-10-25, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interleukin-15 receptor alpha chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13261 (0-65)
  Domains in SCOPe 2.08: d2ersa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ersA (A:)
  itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
  lkcird