PDB entry 2err

View 2err on RCSB PDB site
Description: NMR Structure of the RNA Binding Domain of Human Fox-1 in Complex with UGCAUGU
Class: RNA binding protein
Keywords: protein-RNA complex, RNA binding protein
Deposited on 2005-10-25, released 2006-01-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ataxin-2-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: A2BP1, A2BP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2erra1
  • Chain 'B':
    Compound: ugcaugu
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2errA (A:)
    mgsshhhhhhssglvprgshmntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildve
    iifnergskgfgfvtfensadadrareklhgtvvegrkievnnatarvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2errA (A:)
    ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
    adrareklhgtvvegrkievnnatarvm
    

  • Chain 'B':
    No sequence available.