PDB entry 2err
View 2err on RCSB PDB site
Description: NMR Structure of the RNA Binding Domain of Human Fox-1 in Complex with UGCAUGU
Class: RNA binding protein
Keywords: protein-RNA complex, RNA binding protein
Deposited on
2005-10-25, released
2006-01-10
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ataxin-2-binding protein 1
Species: Homo sapiens [TaxId:9606]
Gene: A2BP1, A2BP
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2erra1 - Chain 'B':
Compound: ugcaugu
Species: synthetic, synthetic
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2errA (A:)
mgsshhhhhhssglvprgshmntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildve
iifnergskgfgfvtfensadadrareklhgtvvegrkievnnatarvm
Sequence, based on observed residues (ATOM records): (download)
>2errA (A:)
ntenksqpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
adrareklhgtvvegrkievnnatarvm
- Chain 'B':
No sequence available.