PDB entry 2erm

View 2erm on RCSB PDB site
Description: Solution structure of a biologically active human FGF-1 monomer, complexed to a hexasaccharide heparin-analogue
Class: hormone/growth factor
Keywords: heparin-like hexasaccharide, fibroblast growth factor, protein-carbohydrate complex, hormone-growth factor complex
Deposited on 2005-10-25, released 2006-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2erma_
  • Heterogens: IPA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ermA (A:)
    nlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstet
    gqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgp
    rthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ermA (A:)
    ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
    dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
    kailflplpvssd