PDB entry 2erl

View 2erl on RCSB PDB site
Description: pheromone er-1 from
Deposited on 1995-12-20, released 1996-07-11
The last revision prior to the SCOP 1.57 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.129
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2erl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2erl_ (-)
    daceqaaiqcvesaceslctegedrtgcymyiysncppyv