PDB entry 2erl

View 2erl on RCSB PDB site
Description: pheromone er-1 from
Class: pheromone
Keywords: pheromone
Deposited on 1995-12-20, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mating pheromone er-1
  Species: Euplotes raikovi [TaxId:5938]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10774 (0-39)
  Domains in SCOPe 2.08: d2erla_
• Heterogens: EOH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2erlA (A:)
  daceqaaiqcvesaceslctegedrtgcymyiysncppyv