PDB entry 2erk

View 2erk on RCSB PDB site
Description: phosphorylated map kinase erk2
Class: phosphotransferase
Keywords: phosphotransferase, kinase, serine/threonine-protein kinase
Deposited on 1997-06-26, released 1998-07-01
The last revision prior to the SCOP 1.73 freeze date was dated 1998-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: extracellular signal-regulated kinase 2
    Species: Rattus norvegicus
    Gene: ERK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63086 (Start-364)
      • modified residue (189)
      • modified residue (191)
    Domains in SCOP 1.73: d2erka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2erkA (A:)
    ahhhhhhmaaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikk
    ispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykl
    lktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvad
    pdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyld
    qlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmlt
    fnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfq
    pgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2erkA (A:)
    aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
    tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
    yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
    vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
    sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
    lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs