PDB entry 2eri

View 2eri on RCSB PDB site
Description: Solution structure of circulin B
Class: antibiotic
Keywords: cystine knot, beta hairpin, beta turn, ANTIBIOTIC
Deposited on 2005-10-24, released 2005-11-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Circulin B
    Species: Chassalia parviflora [TaxId:58431]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2eria_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eriA (A:)
    cgescvfipcistllgcscknkvcyrngvip