PDB entry 2erf

View 2erf on RCSB PDB site
Description: Crystal Structure of the Thrombospondin-1 N-terminal Domain at 1.45A Resolution
Class: sugar binding protein
Keywords: Thrombospondin-1, TSP-1, N-terminal TSPN, HBD
Deposited on 2005-10-24, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.186
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin-1
    Species: HOMO SAPIENS
    Gene: THBS1, TSP, TSP1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2erfa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2erfA (A:)
    ggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrt
    ekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsve
    eallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggv
    ndnfqgvlqnvrfvfgttpedilrnkgcs