PDB entry 2eqz

View 2eqz on RCSB PDB site
Description: Solution structure of the first HMG-box domain from high mobility group protein B3
Class: Transcription
Keywords: HMG-box domain, High mobility group protein B3, mobility group protein 4, mobility group protein 2a, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription
Deposited on 2007-03-30, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: High mobility group protein B3
  Species: Homo sapiens [TaxId:9606]
  Gene: HMGB3
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15347 (7-85)
    • expression tag (0-6)
  Domains in SCOPe 2.06: d2eqza1, d2eqza2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eqzA (A:)
  gssgssgmakgdpkkpkgkmsayaffvqtcreehkkknpevpvnfaefskkcserwktms
  gkekskfdemakadkvrydremkdyg