PDB entry 2eqy

View 2eqy on RCSB PDB site
Description: Solution structure of the ARID domain of Jarid1b protein
Class: DNA binding protein
Keywords: ARID domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jumonji, AT rich interactive domain 1B
    Species: Mus musculus [TaxId:10090]
    Gene: Jarid1b
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80Y84 (7-121)
      • expression tag (0-6)
    Domains in SCOPe 2.04: d2eqya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eqyA (A:)
    gssgssgeaqtrvklnfldqiakywelqgstlkiphverkildlfqlnklvaeeggfavv
    ckdrkwtkiatkmgfapgkavgshirghyerilnpynlflsgdslrclqkpnltsdtkdk
    ey