PDB entry 2eql

View 2eql on RCSB PDB site
Description: crystallographic studies of a calcium binding lysozyme from equine milk at 2.5 angstroms resolution
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-05-27, released 1994-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: horse milk lysozyme
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11376 (0-128)
  Domains in SCOPe 2.04: d2eqla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eqlA (A:)
  kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangssdyglfqln
  nkwwckdnkrsssnacnimcsklldenidddiscakrvvrdpkgmsawkawvkhckdkdl
  seylascnl