PDB entry 2eqc

View 2eqc on RCSB PDB site
Description: Solution structure of Magnesium-bound form of calmodulin C-domain E104D/E140D mutant
Class: metal binding protein
Keywords: calmodulin, EF-hand, Calcium-binding protein, Magnesium-binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2007-03-30, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Xenopus laevis [TaxId:8355]
    Gene: calm1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62155 (Start-71)
      • engineered (27)
      • engineered (63)
    Domains in SCOPe 2.08: d2eqca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eqcA (A:)
    mdtdseeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqv
    nyedfvqmmtak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eqcA (A:)
    eeeireafrvfdkdgngyisaadlrhvmtnlgekltdeevdemireadidgdgqvnyedf
    vqmmtak