PDB entry 2epv

View 2epv on RCSB PDB site
Description: Solution structure of the 20th C2H2 type zinc finger domain of Zinc finger protein 268
Class: transcription
Keywords: C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 268
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF268
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14587 (7-37)
      • expression tag (0-6)
      • expression tag (38-43)
    Domains in SCOPe 2.07: d2epva1, d2epva2, d2epva3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2epvA (A:)
    gssgssgsgekpyecnecgkafiwksllivherthagvsgpssg