PDB entry 2epp

View 2epp on RCSB PDB site
Description: Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 278
Class: transcription
Keywords: C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-03-30, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: POZ-, AT hook-, and zinc finger-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PATZ1, PATZ, RIAZ, ZBTB19, ZNF278, ZSG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HBE1 (7-59)
      • expression tag (0-6)
      • expression tag (60-65)
    Domains in SCOPe 2.07: d2eppa1, d2eppa2, d2eppa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2eppA (A:)
gssgssglreagilpcglcgkvftdanrlrqheaqhgvtslqlgyidlppprlgenglpi
sgpssg