PDB entry 2ep6

View 2ep6 on RCSB PDB site
Description: Solution structure of the second C2 domain from human MCTP2 protein
Class: membrane protein
Keywords: beta sandwich, Ca2+ binding, membrane binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MCTP2 protein
    Species: HOMO SAPIENS
    Gene: MCTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TAX2 (7-132)
      • expression tag (0-6)
    Domains in SCOP 1.75: d2ep6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ep6A (A:)
    gssgssgdvkdvgilqvkvlkaadllaadfsgksdpfcllelgndrlqthtvyknlnpew
    nkvftfpikdihdvlevtvfdedgdkppdflgkvaipllsirdgqpncyvlknkdleqaf
    kgviylemdliyn