PDB entry 2ep6

View 2ep6 on RCSB PDB site
Description: Solution structure of the second C2 domain from human MCTP2 protein
Class: membrane protein
Keywords: beta sandwich, Ca2+ binding, membrane binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MCTP2 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MCTP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8TAX2 (7-132)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2ep6a1, d2ep6a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ep6A (A:)
  gssgssgdvkdvgilqvkvlkaadllaadfsgksdpfcllelgndrlqthtvyknlnpew
  nkvftfpikdihdvlevtvfdedgdkppdflgkvaipllsirdgqpncyvlknkdleqaf
  kgviylemdliyn