PDB entry 2eog

View 2eog on RCSB PDB site
Description: Solution structure of the C2H2 type zinc finger (region 693-723) of human Zinc finger protein 268
Class: transcription
Keywords: zf-C2H2, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-03-29, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 268
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF268
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14587 (7-37)
      • expression tag (0-6)
      • expression tag (38-43)
    Domains in SCOPe 2.08: d2eoga1, d2eoga2, d2eoga3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eogA (A:)
    gssgssgvkpygcsecgkafrsksyliihmrthtgekpsgpssg