PDB entry 2eob

View 2eob on RCSB PDB site
Description: Solution structure of the second SH2 domain from rat PLC gamma-2
Class: hydrolase
Keywords: sh2, Phosphoinositide phospholipase C, PLC-gamma-2, Phospholipase C-gamma-2, PLC-IV, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, hydrolase
Deposited on 2007-03-29, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Plcg2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24135 (7-117)
    • expression tag (0-6)
    • expression tag (118-123)
  Domains in SCOPe 2.08: d2eoba1, d2eoba2, d2eoba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2eobA (A:)
  gssgssgdpvpnpnpheskpwyydrlsrgeaedmlmriprdgaflirkregtdsyaitfr
  argkvkhcrinrdgrhfvlgtsayfeslvelvsyyekhalyrkmrlrypvtpellerysg
  pssg