PDB entry 2eo6

View 2eo6 on RCSB PDB site
Description: Solution structure of the SH2 domain from mouse B-cell linker protein BLNK
Class: signaling protein
Keywords: sh2, Cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein, B-cell adapter containing Src homology 2 domain protein, Src homology 2 domain-containing leukocyte protein of 65 kDa, Slp-65, Lymphocyte antigen 57, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-03-29, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell linker protein
    Species: Mus musculus [TaxId:10090]
    Gene: Blnk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QUN3 (7-134)
      • expression tag (0-6)
      • expression tag (135-140)
    Domains in SCOPe 2.07: d2eo6a1, d2eo6a2, d2eo6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eo6A (A:)
    gssgssgpfnstfadqeaellgkpwyagacdrksaeealhrsnkdgsflirkssghdskq
    pytlvaffnkrvynipvrfieatkqyalgkkkngeeyfgsvveivnshqhnplvlidsqn
    ntkdstrlkyavkvssgpssg