PDB entry 2eny

View 2eny on RCSB PDB site
Description: Solution structure of the ig-like domain (2735-2825) of human obscurin
Class: contractile protein
Keywords: beta-sandwich, ig-fold, Obscurin-myosin light chain kinase, Obscurin-MLCK, Obscurin-RhoGEF, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin
    Species: Homo sapiens [TaxId:9606]
    Gene: OBSCN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VST9 (7-97)
      • expression tag (0-6)
      • expression tag (98-103)
    Domains in SCOPe 2.08: d2enya1, d2enya2, d2enya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2enyA (A:)
    gssgssghvgitkrlktmevlegescsfecvlshesasdpamwtvggktvgsssrfqatr
    qgrkyilvvreaapsdagevvfsvrgltskaslivrersgpssg