PDB entry 2enp

View 2enp on RCSB PDB site
Description: Solution structure of the first C2 domain from human B/K protein
Class: transport protein
Keywords: C2 Type 1,beta sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSPORT PROTEIN
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B/K protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT17
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ18 (7-140)
      • expression tag (0-6)
      • expression tag (141-146)
    Domains in SCOPe 2.07: d2enpa1, d2enpa2, d2enpa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2enpA (A:)
    gssgssgskyqlgmlhfstqydllhnhltvrvieardlpppishdgsrqdmahsnpyvki
    cllpdqknskqtgvkrktqkpvfeerytfeipfleaqrrtllltvvdfdkfsrhcvigkv
    svplcevdlvkgghwwkalipsgpssg