PDB entry 2enm

View 2enm on RCSB PDB site
Description: Solution structure of the SH3 domain from mouse sorting nexin-9
Class: endocytosis
Keywords: SH3-like barrel, Protein transport, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorting nexin-9
    Species: Mus musculus [TaxId:10090]
    Gene: Snx9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91VH2 (7-76)
      • expression tag (0-6)
    Domains in SCOPe 2.06: d2enma1, d2enma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2enmA (A:)
    gssgssgmatkarvmydfaaepgnneltvtegeiitvtnpnvgggwlegknnkgeqglvp
    tdyveilpndgkdpfsc