PDB entry 2enj

View 2enj on RCSB PDB site
Description: Solution sturcture of the C2 domain from human protein kinase C theta
Class: transferase
Keywords: beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, PKC, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2007-03-28, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C theta type
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04759 (7-131)
      • expression tag (0-6)
      • expression tag (132-137)
    Domains in SCOPe 2.07: d2enja1, d2enja2, d2enja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2enjA (A:)
    gssgssgmspflriglsnfdcgscqscqgeavnpycavlvkeyvesengqmyiqkkptmy
    ppwdstfdahinkgrvmqiivkgknvdlisettvelyslaercrknngkteiwlelkpqg
    rmlmnaryflemsgpssg