PDB entry 2emg

View 2emg on RCSB PDB site
Description: Solution structure of the C2H2 type zinc finger (region 463-495) of human Zinc finger protein 484
Class: transcription
Keywords: zf-C2H2, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 484
    Species: HOMO SAPIENS
    Gene: ZNF484
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JVG2 (7-39)
      • expression tag (0-6)
      • expression tag (40-45)
    Domains in SCOP 1.75: d2emga1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2emgA (A:)
    gssgssgtgenpficsecgkvfthktnliihqkihtgerpsgpssg