PDB entry 2el5

View 2el5 on RCSB PDB site
Description: Solution structure of the 18th zf-C2H2 domain from human Zinc finger protein 268
Class: transcription
Keywords: Alternative splicing, DNA-binding, Metal-binding, Nuclear protein, Repeat, Transcription, Transcription regulation, Zinc, Zinc-finger, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-26, released 2007-10-02
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 268
    Species: HOMO SAPIENS
    Gene: ZNF268
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14587 (7-35)
      • expression tag (0-6)
      • expression tag (36-41)
    Domains in SCOP 1.75: d2el5a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2el5A (A:)
    gssgssgenpyecsecgkafnrkdqlishqrthagesgpssg