PDB entry 2ekz

View 2ekz on RCSB PDB site
Description: Structural study of Project ID TTHB049 from Thermus thermophilus HB8 (L52M)
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-26, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-ribazole-5'-phosphate phosphatase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53WB3 (0-End)
      • engineered (51)
    Domains in SCOPe 2.07: d2ekza_
  • Chain 'B':
    Compound: Alpha-ribazole-5'-phosphate phosphatase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53WB3 (0-End)
      • engineered (51)
    Domains in SCOPe 2.07: d2ekzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ekzA (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekzA (A:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ekzB (B:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlaldgeeatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekzB (B:)
    melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdmlrarrtae
    lagfsprlypelreihfgalegalwetldprykeallrfqgfhppggeslsafqervfrf
    leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal