PDB entry 2ekx

View 2ekx on RCSB PDB site
Description: Solution structure of the human BMX SH2 domain
Class: signaling protein
Keywords: SH2 domain, Phosphotyrosine binding domain, Protein Tyrosine Kinase, Signal Transduction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-03-26, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytoplasmic tyrosine-protein kinase BMX
  Species: Homo sapiens [TaxId:9606]
  Gene: BMX
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51813 (7-109)
    • expression tag (0-6)
  Domains in SCOPe 2.07: d2ekxa1, d2ekxa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ekxA (A:)
  gssgssglddydwfagnisrsqseqllrqkgkegafmvrnssqvgmytvslfskavndkk
  gtvkhyhvhtnaenklylaenycfdsipklihyhqhnsagmitrlrhpvs