PDB entry 2ekq

View 2ekq on RCSB PDB site
Description: Structure of TT0495 protein from Thermus thermophilus
Class: oxidoreductase
Keywords: gluconate dehydrogenase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, OXIDOREDUCTASE
Deposited on 2007-03-23, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ekqa_
  • Chain 'B':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ekqb_
  • Chain 'C':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ekqc_
  • Chain 'D':
    Compound: 2-deoxy-D-gluconate 3-dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ekqd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ekqA (A:)
    merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
    vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
    wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
    ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekqA (A:)
    erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
    kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
    grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef
    tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ekqB (B:)
    merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
    vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
    wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
    ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekqB (B:)
    erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
    kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
    grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef
    tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ekqC (C:)
    merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
    vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
    wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
    ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekqC (C:)
    erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
    kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
    grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetef
    tlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ekqD (D:)
    merkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkgl
    vkralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeag
    wgrvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvete
    ftlplrqnpelyepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekqD (D:)
    erkalvtggsrgigraiaealvargyrvaiasrnpeeaaqslgavplptdlekddpkglv
    kralealgglhvlvhaaavnvrkpalelsyeewrrvlylhldvafllaqaaaphmaeagw
    grvlfigsvttftaggpvpipayttaktallgltralakewarlgirvnllcpgyvetel
    yepitaripmgrwarpeeiarvaavlcgdeaeyltgqavavdggflay