PDB entry 2eke
View 2eke on RCSB PDB site
Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
Class: ligase/protein binding
Keywords: Ubc9, Smt3, SUMO binding motif, SBM
Deposited on
2007-03-23, released
2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated
2007-05-29, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.225
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: SUMO-conjugating enzyme UBC9
Species: Saccharomyces cerevisiae
Gene: UBC9
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: SUMO-conjugating enzyme UBC9
Species: Saccharomyces cerevisiae
Gene: UBC9
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Ubiquitin-like protein SMT3
Species: Saccharomyces cerevisiae
Gene: SMT3
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2ekec1 - Chain 'D':
Compound: Ubiquitin-like protein SMT3
Species: Saccharomyces cerevisiae
Gene: SMT3
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2eked1 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2ekeC (C:)
mgsshhhhhhsqdplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeaf
akrqgkemdslrflydgiriqadqtpedldmedndiieahreqigg
Sequence, based on observed residues (ATOM records): (download)
>2ekeC (C:)
dplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslr
flydgiriqadqtpedldmedndiieahreq
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2ekeD (D:)
mgsshhhhhhsqdplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeaf
akrqgkemdslrflydgiriqadqtpedldmedndiieahreqigg
Sequence, based on observed residues (ATOM records): (download)
>2ekeD (D:)
dplvprgsevkpkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrfl
ydgiriqadqtpedldmedndiieahre