PDB entry 2eke

View 2eke on RCSB PDB site
Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway
Class: ligase/protein binding
Keywords: Ubc9, Smt3, SUMO binding motif, SBM
Deposited on 2007-03-23, released 2007-05-29
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.225
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-conjugating enzyme UBC9
    Species: Saccharomyces cerevisiae
    Gene: UBC9
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: SUMO-conjugating enzyme UBC9
    Species: Saccharomyces cerevisiae
    Gene: UBC9
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae
    Gene: SMT3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12306 (20-End)
      • cloning artifact (12-19)
    Domains in SCOP 1.73: d2ekec1
  • Chain 'D':
    Compound: Ubiquitin-like protein SMT3
    Species: Saccharomyces cerevisiae
    Gene: SMT3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12306 (20-End)
      • cloning artifact (12-19)
    Domains in SCOP 1.73: d2eked1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ekeC (C:)
    mgsshhhhhhsqdplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeaf
    akrqgkemdslrflydgiriqadqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekeC (C:)
    dplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslr
    flydgiriqadqtpedldmedndiieahreq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ekeD (D:)
    mgsshhhhhhsqdplvprgsevkpevkpethinlkvsdgsseiffkikkttplrrlmeaf
    akrqgkemdslrflydgiriqadqtpedldmedndiieahreqigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ekeD (D:)
    dplvprgsevkpkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrfl
    ydgiriqadqtpedldmedndiieahre